Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1983640..1984223 | Replicon | chromosome |
| Accession | NZ_CP117001 | ||
| Organism | Escherichia coli strain MLI108K2 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | NL410_RS11645 | Protein ID | WP_000254738.1 |
| Coordinates | 1983640..1983975 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NL410_RS11650 | Protein ID | WP_000581937.1 |
| Coordinates | 1983975..1984223 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL410_RS11625 (1979109) | 1979109..1979471 | + | 363 | WP_000034928.1 | hypothetical protein | - |
| NL410_RS11630 (1979527) | 1979527..1980825 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| NL410_RS11635 (1980913) | 1980913..1982550 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NL410_RS11640 (1982778) | 1982778..1983569 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NL410_RS11645 (1983640) | 1983640..1983975 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| NL410_RS11650 (1983975) | 1983975..1984223 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NL410_RS11655 (1984301) | 1984301..1986535 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NL410_RS11660 (1986583) | 1986583..1987884 | - | 1302 | WP_046464058.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T269718 WP_000254738.1 NZ_CP117001:c1983975-1983640 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|