Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 23281..23882 Replicon plasmid p92_MLI108-2
Accession NZ_CP116996
Organism Escherichia coli strain MLI108K2

Toxin (Protein)


Gene name doc Uniprot ID A0A5M4JUN5
Locus tag NL410_RS01250 Protein ID WP_001216041.1
Coordinates 23502..23882 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NL410_RS01245 Protein ID WP_001190712.1
Coordinates 23281..23502 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL410_RS01205 (NL410_001205) 19247..19939 + 693 WP_219394458.1 hypothetical protein -
NL410_RS01210 (NL410_001210) 19932..20198 + 267 WP_247193450.1 hypothetical protein -
NL410_RS01215 (NL410_001215) 20185..20802 + 618 WP_247193449.1 ead/Ea22-like family protein -
NL410_RS01220 (NL410_001220) 20807..21808 + 1002 WP_247193448.1 hypothetical protein -
NL410_RS01225 (NL410_001225) 21792..22076 + 285 WP_001142396.1 hypothetical protein -
NL410_RS01230 (NL410_001230) 22061..22411 - 351 WP_001436207.1 hypothetical protein -
NL410_RS01235 (NL410_001235) 22444..22695 + 252 WP_001283837.1 DNA polymerase III subunit theta -
NL410_RS01240 (NL410_001240) 22819..23208 + 390 WP_000506731.1 S24 family peptidase -
NL410_RS01245 (NL410_001245) 23281..23502 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL410_RS01250 (NL410_001250) 23502..23882 + 381 WP_001216041.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL410_RS01255 (NL410_001255) 23966..24766 - 801 WP_000432093.1 hypothetical protein -
NL410_RS01260 (NL410_001260) 24773..25450 - 678 WP_001061874.1 DUF2829 domain-containing protein -
NL410_RS01265 (NL410_001265) 25465..25959 - 495 WP_000640907.1 dUTP diphosphatase -
NL410_RS01270 (NL410_001270) 25956..26432 - 477 WP_000861175.1 hypothetical protein -
NL410_RS01275 (NL410_001275) 26429..26773 - 345 WP_001191776.1 hypothetical protein -
NL410_RS01280 (NL410_001280) 26847..27875 - 1029 WP_001292230.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..92487 92487


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13635.52 Da        Isoelectric Point: 5.6406

>T269707 WP_001216041.1 NZ_CP116996:23502-23882 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT269707 WP_001190712.1 NZ_CP116996:23281-23502 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5M4JUN5

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References