Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 23281..23882 | Replicon | plasmid p92_MLI108-2 |
Accession | NZ_CP116996 | ||
Organism | Escherichia coli strain MLI108K2 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A5M4JUN5 |
Locus tag | NL410_RS01250 | Protein ID | WP_001216041.1 |
Coordinates | 23502..23882 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | NL410_RS01245 | Protein ID | WP_001190712.1 |
Coordinates | 23281..23502 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL410_RS01205 (NL410_001205) | 19247..19939 | + | 693 | WP_219394458.1 | hypothetical protein | - |
NL410_RS01210 (NL410_001210) | 19932..20198 | + | 267 | WP_247193450.1 | hypothetical protein | - |
NL410_RS01215 (NL410_001215) | 20185..20802 | + | 618 | WP_247193449.1 | ead/Ea22-like family protein | - |
NL410_RS01220 (NL410_001220) | 20807..21808 | + | 1002 | WP_247193448.1 | hypothetical protein | - |
NL410_RS01225 (NL410_001225) | 21792..22076 | + | 285 | WP_001142396.1 | hypothetical protein | - |
NL410_RS01230 (NL410_001230) | 22061..22411 | - | 351 | WP_001436207.1 | hypothetical protein | - |
NL410_RS01235 (NL410_001235) | 22444..22695 | + | 252 | WP_001283837.1 | DNA polymerase III subunit theta | - |
NL410_RS01240 (NL410_001240) | 22819..23208 | + | 390 | WP_000506731.1 | S24 family peptidase | - |
NL410_RS01245 (NL410_001245) | 23281..23502 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL410_RS01250 (NL410_001250) | 23502..23882 | + | 381 | WP_001216041.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NL410_RS01255 (NL410_001255) | 23966..24766 | - | 801 | WP_000432093.1 | hypothetical protein | - |
NL410_RS01260 (NL410_001260) | 24773..25450 | - | 678 | WP_001061874.1 | DUF2829 domain-containing protein | - |
NL410_RS01265 (NL410_001265) | 25465..25959 | - | 495 | WP_000640907.1 | dUTP diphosphatase | - |
NL410_RS01270 (NL410_001270) | 25956..26432 | - | 477 | WP_000861175.1 | hypothetical protein | - |
NL410_RS01275 (NL410_001275) | 26429..26773 | - | 345 | WP_001191776.1 | hypothetical protein | - |
NL410_RS01280 (NL410_001280) | 26847..27875 | - | 1029 | WP_001292230.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..92487 | 92487 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13635.52 Da Isoelectric Point: 5.6406
>T269707 WP_001216041.1 NZ_CP116996:23502-23882 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M4JUN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |