Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 68626..69269 | Replicon | plasmid p172_MLI108-2 |
| Accession | NZ_CP116995 | ||
| Organism | Escherichia coli strain MLI108K2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | NL410_RS00375 | Protein ID | WP_001034044.1 |
| Coordinates | 68626..69042 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | NL410_RS00380 | Protein ID | WP_001261286.1 |
| Coordinates | 69039..69269 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL410_RS00360 (65028) | 65028..65725 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| NL410_RS00365 (65979) | 65979..67001 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| NL410_RS00370 (66986) | 66986..68551 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| NL410_RS00375 (68626) | 68626..69042 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NL410_RS00380 (69039) | 69039..69269 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NL410_RS00385 (69829) | 69829..70047 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NL410_RS00390 (70049) | 70049..70354 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| NL410_RS00395 (70355) | 70355..71161 | + | 807 | WP_000016970.1 | site-specific integrase | - |
| NL410_RS00400 (71883) | 71883..72638 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / mph(A) / sitABCD / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 | iucA / iucB / iucC / iucD / iutA | 1..172011 | 172011 | |
| - | flank | IS/Tn | - | - | 65222..65725 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T269697 WP_001034044.1 NZ_CP116995:c69042-68626 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |