Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3709919..3710751 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A7ZVJ9 |
Locus tag | NL409_RS19995 | Protein ID | WP_000854765.1 |
Coordinates | 3710377..3710751 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | NL409_RS19990 | Protein ID | WP_001295723.1 |
Coordinates | 3709919..3710287 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS19965 (3707034) | 3707034..3707229 | + | 196 | Protein_3550 | DUF905 family protein | - |
NL409_RS19970 (3707347) | 3707347..3708165 | + | 819 | WP_046464190.1 | DUF932 domain-containing protein | - |
NL409_RS19975 (3708507) | 3708507..3708980 | + | 474 | WP_000855059.1 | antirestriction protein | - |
NL409_RS19980 (3708996) | 3708996..3709472 | + | 477 | WP_001186774.1 | RadC family protein | - |
NL409_RS19985 (3709535) | 3709535..3709756 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
NL409_RS19990 (3709919) | 3709919..3710287 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NL409_RS19995 (3710377) | 3710377..3710751 | + | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
NL409_RS20000 (3710748) | 3710748..3711239 | + | 492 | WP_000976842.1 | DUF5983 family protein | - |
NL409_RS20005 (3711256) | 3711256..3711432 | + | 177 | WP_000839290.1 | DUF957 domain-containing protein | - |
NL409_RS20010 (3711538) | 3711538..3711687 | + | 150 | Protein_3559 | hypothetical protein | - |
NL409_RS20015 (3712178) | 3712178..3715294 | - | 3117 | WP_000149665.1 | HsdR family type I site-specific deoxyribonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T269692 WP_000854765.1 NZ_CP116994:3710377-3710751 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT269692 WP_001295723.1 NZ_CP116994:3709919-3710287 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|