Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3595148..3595743 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | NL409_RS19380 | Protein ID | WP_000239579.1 |
Coordinates | 3595393..3595743 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | NL409_RS19375 | Protein ID | WP_001223208.1 |
Coordinates | 3595148..3595399 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS19365 (3590812) | 3590812..3594591 | + | 3780 | WP_000060921.1 | autotransporter assembly complex protein TamB | - |
NL409_RS19370 (3594594) | 3594594..3594935 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NL409_RS19375 (3595148) | 3595148..3595399 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NL409_RS19380 (3595393) | 3595393..3595743 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
NL409_RS19385 (3595823) | 3595823..3596353 | - | 531 | WP_000055072.1 | inorganic diphosphatase | - |
NL409_RS19390 (3596663) | 3596663..3597619 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NL409_RS19395 (3597929) | 3597929..3599431 | + | 1503 | WP_000205791.1 | sugar ABC transporter ATP-binding protein | - |
NL409_RS19400 (3599445) | 3599445..3600467 | + | 1023 | WP_024198507.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T269691 WP_000239579.1 NZ_CP116994:3595393-3595743 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |