Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2159159..2159813 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | NL409_RS12430 | Protein ID | WP_000244772.1 |
Coordinates | 2159159..2159566 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NL409_RS12435 | Protein ID | WP_000354046.1 |
Coordinates | 2159547..2159813 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS12410 (2155116) | 2155116..2156849 | - | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NL409_RS12415 (2156855) | 2156855..2157565 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL409_RS12420 (2157590) | 2157590..2158486 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NL409_RS12425 (2158598) | 2158598..2159119 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NL409_RS12430 (2159159) | 2159159..2159566 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
NL409_RS12435 (2159547) | 2159547..2159813 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NL409_RS12440 (2160056) | 2160056..2161036 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NL409_RS12445 (2161113) | 2161113..2161772 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NL409_RS12450 (2161936) | 2161936..2162247 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
NL409_RS12455 (2162292) | 2162292..2163725 | + | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
NL409_RS12460 (2163782) | 2163782..2164525 | - | 744 | WP_000951940.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T269688 WP_000244772.1 NZ_CP116994:c2159566-2159159 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |