Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1982884..1983467 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NL409_RS11630 | Protein ID | WP_000254738.1 |
Coordinates | 1982884..1983219 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NL409_RS11635 | Protein ID | WP_000581937.1 |
Coordinates | 1983219..1983467 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS11610 (1978353) | 1978353..1978715 | + | 363 | WP_000034928.1 | hypothetical protein | - |
NL409_RS11615 (1978771) | 1978771..1980069 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
NL409_RS11620 (1980157) | 1980157..1981794 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NL409_RS11625 (1982022) | 1982022..1982813 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NL409_RS11630 (1982884) | 1982884..1983219 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NL409_RS11635 (1983219) | 1983219..1983467 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NL409_RS11640 (1983545) | 1983545..1985779 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NL409_RS11645 (1985827) | 1985827..1987128 | - | 1302 | WP_046464058.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T269687 WP_000254738.1 NZ_CP116994:c1983219-1982884 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|