Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1698616..1699241 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NL409_RS10235 | Protein ID | WP_000911329.1 |
Coordinates | 1698616..1699014 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NL409_RS10240 | Protein ID | WP_000450524.1 |
Coordinates | 1699014..1699241 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS10215 (1694494) | 1694494..1694694 | + | 201 | WP_000383836.1 | YpfN family protein | - |
NL409_RS10220 (1694804) | 1694804..1695502 | - | 699 | WP_000679812.1 | esterase | - |
NL409_RS10225 (1695576) | 1695576..1697591 | - | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NL409_RS10230 (1697606) | 1697606..1698469 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
NL409_RS10235 (1698616) | 1698616..1699014 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NL409_RS10240 (1699014) | 1699014..1699241 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NL409_RS10245 (1699397) | 1699397..1700110 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NL409_RS10250 (1700323) | 1700323..1701357 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NL409_RS10255 (1701374) | 1701374..1702252 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NL409_RS10260 (1702398) | 1702398..1702970 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NL409_RS10265 (1702970) | 1702970..1703440 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T269686 WP_000911329.1 NZ_CP116994:c1699014-1698616 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |