Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1210516..1211351 Replicon chromosome
Accession NZ_CP116994
Organism Escherichia coli strain MLI108K1

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X9TM58
Locus tag NL409_RS07990 Protein ID WP_000854761.1
Coordinates 1210974..1211351 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag NL409_RS07985 Protein ID WP_001295723.1
Coordinates 1210516..1210884 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL409_RS07960 (1207632) 1207632..1207827 + 196 Protein_1219 DUF905 family protein -
NL409_RS07965 (1207945) 1207945..1208763 + 819 WP_046464190.1 DUF932 domain-containing protein -
NL409_RS07970 (1209105) 1209105..1209578 + 474 WP_000855059.1 antirestriction protein -
NL409_RS07975 (1209593) 1209593..1210069 + 477 WP_001186711.1 RadC family protein -
NL409_RS07980 (1210132) 1210132..1210353 + 222 WP_000692345.1 DUF987 domain-containing protein -
NL409_RS07985 (1210516) 1210516..1210884 + 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NL409_RS07990 (1210974) 1210974..1211351 + 378 WP_000854761.1 TA system toxin CbtA family protein Toxin
NL409_RS07995 (1211348) 1211348..1211496 + 149 Protein_1226 DUF5983 family protein -
NL409_RS08000 (1211596) 1211596..1211676 + 81 Protein_1227 hypothetical protein -
NL409_RS08005 (1212107) 1212107..1213646 - 1540 Protein_1228 IS66-like element ISEc22 family transposase -
NL409_RS08010 (1213695) 1213695..1214042 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
NL409_RS08015 (1214039) 1214039..1214443 - 405 WP_000839179.1 transposase -
NL409_RS08020 (1214524) 1214524..1214748 + 225 Protein_1231 transposase -
NL409_RS08025 (1214955) 1214955..1215326 + 372 WP_001295631.1 IS110 family transposase -
NL409_RS08030 (1215696) 1215696..1215962 + 267 WP_087757644.1 EutP/PduV family microcompartment system protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14205.25 Da        Isoelectric Point: 7.3249

>T269684 WP_000854761.1 NZ_CP116994:1210974-1211351 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT269684 WP_001295723.1 NZ_CP116994:1210516-1210884 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X9TM58

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References