Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 68626..69269 Replicon plasmid p172_MLI108-1
Accession NZ_CP116988
Organism Escherichia coli strain MLI108K1

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag NL409_RS00375 Protein ID WP_001034044.1
Coordinates 68626..69042 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag NL409_RS00380 Protein ID WP_001261286.1
Coordinates 69039..69269 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL409_RS00360 (65028) 65028..65725 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
NL409_RS00365 (65979) 65979..67001 - 1023 WP_000361402.1 helicase UvrD -
NL409_RS00370 (66986) 66986..68551 - 1566 WP_001128474.1 AAA family ATPase -
NL409_RS00375 (68626) 68626..69042 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
NL409_RS00380 (69039) 69039..69269 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NL409_RS00385 (69829) 69829..70047 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
NL409_RS00390 (70049) 70049..70354 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NL409_RS00395 (70355) 70355..71161 + 807 WP_000016970.1 site-specific integrase -
NL409_RS00400 (71883) 71883..72638 + 756 WP_000852146.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / mph(A) / sitABCD / aac(6')-Ib-cr / blaOXA-1 / aac(3)-IIa / blaCTX-M-15 / aadA5 / qacE / sul1 iucA / iucB / iucC / iucD / iutA 1..172011 172011
- flank IS/Tn - - 65222..65725 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T269666 WP_001034044.1 NZ_CP116988:c69042-68626 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT269666 WP_001261286.1 NZ_CP116988:c69269-69039 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References