Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4213945..4214540 | Replicon | chromosome |
Accession | NZ_CP116987 | ||
Organism | Escherichia coli strain MLI107 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | NL408_RS20490 | Protein ID | WP_000239579.1 |
Coordinates | 4213945..4214295 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | A0A4D0VVQ9 |
Locus tag | NL408_RS20495 | Protein ID | WP_001223207.1 |
Coordinates | 4214289..4214540 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL408_RS20470 (4209221) | 4209221..4210243 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
NL408_RS20475 (4210257) | 4210257..4211759 | - | 1503 | WP_000205795.1 | sugar ABC transporter ATP-binding protein | - |
NL408_RS20480 (4212069) | 4212069..4213025 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NL408_RS20485 (4213335) | 4213335..4213865 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
NL408_RS20490 (4213945) | 4213945..4214295 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
NL408_RS20495 (4214289) | 4214289..4214540 | - | 252 | WP_001223207.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NL408_RS20500 (4214753) | 4214753..4215094 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NL408_RS20505 (4215097) | 4215097..4218876 | - | 3780 | WP_000060927.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T269663 WP_000239579.1 NZ_CP116987:c4214295-4213945 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D0VVQ9 |