Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 4138470..4139245 | Replicon | chromosome |
| Accession | NZ_CP116987 | ||
| Organism | Escherichia coli strain MLI107 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7V7JG91 |
| Locus tag | NL408_RS20145 | Protein ID | WP_001193488.1 |
| Coordinates | 4138470..4138841 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7V7JFU6 |
| Locus tag | NL408_RS20150 | Protein ID | WP_001059301.1 |
| Coordinates | 4138880..4139245 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL408_RS20120 (4133552) | 4133552..4134658 | + | 1107 | WP_001044128.1 | N-acetylneuraminate epimerase | - |
| NL408_RS20125 (4134723) | 4134723..4135703 | + | 981 | WP_001366032.1 | sialate O-acetylesterase | - |
| NL408_RS20130 (4135711) | 4135711..4135815 | - | 105 | Protein_3937 | HNH endonuclease | - |
| NL408_RS20135 (4135915) | 4135915..4136787 | + | 873 | WP_000168567.1 | HNH endonuclease | - |
| NL408_RS20140 (4136898) | 4136898..4137896 | - | 999 | WP_001240355.1 | membrane protein | - |
| NL408_RS20145 (4138470) | 4138470..4138841 | - | 372 | WP_001193488.1 | TA system toxin CbtA family protein | Toxin |
| NL408_RS20150 (4138880) | 4138880..4139245 | - | 366 | WP_001059301.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NL408_RS20155 (4139271) | 4139271..4139492 | - | 222 | WP_000691983.1 | DUF987 domain-containing protein | - |
| NL408_RS20160 (4139489) | 4139489..4140031 | - | 543 | WP_015740440.1 | DNA repair protein RadC | - |
| NL408_RS20165 (4140044) | 4140044..4140487 | - | 444 | WP_001096016.1 | antirestriction protein | - |
| NL408_RS20170 (4140518) | 4140518..4141339 | - | 822 | WP_001234409.1 | DUF932 domain-containing protein | - |
| NL408_RS20175 (4141459) | 4141459..4141932 | - | 474 | WP_001298943.1 | hypothetical protein | - |
| NL408_RS20180 (4142004) | 4142004..4142456 | - | 453 | WP_000734321.1 | hypothetical protein | - |
| NL408_RS20185 (4142492) | 4142492..4143208 | - | 717 | WP_000174910.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB | 4130759..4148575 | 17816 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13832.94 Da Isoelectric Point: 7.2419
>T269662 WP_001193488.1 NZ_CP116987:c4138841-4138470 [Escherichia coli]
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYELVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL
Download Length: 372 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13388.25 Da Isoelectric Point: 5.9530
>AT269662 WP_001059301.1 NZ_CP116987:c4139245-4138880 [Escherichia coli]
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JG91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7JFU6 |