Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3713676..3714365 | Replicon | chromosome |
Accession | NZ_CP116987 | ||
Organism | Escherichia coli strain MLI107 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | NL408_RS18190 | Protein ID | WP_206311470.1 |
Coordinates | 3713676..3714014 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NL408_RS18195 | Protein ID | WP_206311471.1 |
Coordinates | 3714039..3714365 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL408_RS18175 (3710689) | 3710689..3711645 | + | 957 | WP_000121330.1 | molybdenum cofactor insertion chaperone PaoD | - |
NL408_RS18180 (3711696) | 3711696..3712034 | + | 339 | Protein_3558 | LysR substrate-binding domain-containing protein | - |
NL408_RS18185 (3712535) | 3712535..3713284 | - | 750 | WP_206311469.1 | hypothetical protein | - |
NL408_RS18190 (3713676) | 3713676..3714014 | - | 339 | WP_206311470.1 | TA system toxin CbtA family protein | Toxin |
NL408_RS18195 (3714039) | 3714039..3714365 | - | 327 | WP_206311471.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NL408_RS18200 (3714408) | 3714408..3714887 | - | 480 | WP_206311472.1 | DNA repair protein RadC | - |
NL408_RS18205 (3714900) | 3714900..3715364 | - | 465 | WP_206311473.1 | antirestriction protein | - |
NL408_RS18210 (3715425) | 3715425..3716243 | - | 819 | WP_206311474.1 | DUF932 domain-containing protein | - |
NL408_RS18215 (3716705) | 3716705..3717328 | + | 624 | WP_206311475.1 | inovirus Gp2 family protein | - |
NL408_RS18220 (3717433) | 3717433..3717663 | + | 231 | WP_206311486.1 | AlpA family phage regulatory protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3686959..3731581 | 44622 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12840.78 Da Isoelectric Point: 9.1652
>T269660 WP_206311470.1 NZ_CP116987:c3714014-3713676 [Escherichia coli]
MKTLPANQRVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLRQRHHPSAR
MKTLPANQRVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLRQRHHPSAR
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|