Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3551911..3552748 | Replicon | chromosome |
Accession | NZ_CP116987 | ||
Organism | Escherichia coli strain MLI107 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NL408_RS17455 | Protein ID | WP_000227784.1 |
Coordinates | 3552206..3552748 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NL408_RS17450 | Protein ID | WP_001297137.1 |
Coordinates | 3551911..3552222 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL408_RS17425 (3546931) | 3546931..3547878 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NL408_RS17430 (3547900) | 3547900..3549891 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NL408_RS17435 (3549881) | 3549881..3550495 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NL408_RS17440 (3550495) | 3550495..3550824 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NL408_RS17445 (3550836) | 3550836..3551726 | + | 891 | WP_000971336.1 | heme o synthase | - |
NL408_RS17450 (3551911) | 3551911..3552222 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NL408_RS17455 (3552206) | 3552206..3552748 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NL408_RS17460 (3552804) | 3552804..3553739 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
NL408_RS17465 (3554147) | 3554147..3555511 | + | 1365 | WP_001000975.1 | MFS transporter | - |
NL408_RS17470 (3555639) | 3555639..3556130 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NL408_RS17475 (3556298) | 3556298..3557209 | + | 912 | WP_000705877.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T269659 WP_000227784.1 NZ_CP116987:3552206-3552748 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|