Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1297662..1298287 | Replicon | chromosome |
Accession | NZ_CP116987 | ||
Organism | Escherichia coli strain MLI107 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NL408_RS06280 | Protein ID | WP_000911329.1 |
Coordinates | 1297889..1298287 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NL408_RS06275 | Protein ID | WP_000450524.1 |
Coordinates | 1297662..1297889 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL408_RS06250 (1293464) | 1293464..1293934 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NL408_RS06255 (1293934) | 1293934..1294506 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NL408_RS06260 (1294652) | 1294652..1295530 | + | 879 | WP_001311023.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NL408_RS06265 (1295547) | 1295547..1296581 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NL408_RS06270 (1296794) | 1296794..1297507 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NL408_RS06275 (1297662) | 1297662..1297889 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NL408_RS06280 (1297889) | 1297889..1298287 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NL408_RS06285 (1298434) | 1298434..1299297 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NL408_RS06290 (1299312) | 1299312..1301327 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NL408_RS06295 (1301401) | 1301401..1302099 | + | 699 | WP_000679823.1 | esterase | - |
NL408_RS06300 (1302209) | 1302209..1302409 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T269651 WP_000911329.1 NZ_CP116987:1297889-1298287 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |