Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 304706..305506 | Replicon | chromosome |
| Accession | NZ_CP116987 | ||
| Organism | Escherichia coli strain MLI107 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4NNI0 |
| Locus tag | NL408_RS01405 | Protein ID | WP_000342449.1 |
| Coordinates | 304979..305506 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | NL408_RS01400 | Protein ID | WP_001277108.1 |
| Coordinates | 304706..304972 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL408_RS01380 (300364) | 300364..301032 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| NL408_RS01385 (301025) | 301025..302083 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| NL408_RS01390 (302328) | 302328..303182 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NL408_RS01395 (303453) | 303453..304556 | + | 1104 | WP_255141743.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NL408_RS01400 (304706) | 304706..304972 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NL408_RS01405 (304979) | 304979..305506 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NL408_RS01410 (305503) | 305503..305886 | - | 384 | WP_206311438.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NL408_RS01415 (306310) | 306310..307419 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NL408_RS01420 (307467) | 307467..308393 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NL408_RS01425 (308390) | 308390..309667 | + | 1278 | WP_000803784.1 | branched chain amino acid ABC transporter permease LivM | - |
| NL408_RS01430 (309664) | 309664..310431 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T269647 WP_000342449.1 NZ_CP116987:304979-305506 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |