Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 23642..24164 Replicon plasmid pE6474.3
Accession NZ_CP116984
Organism Escherichia coli strain E6474

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PO910_RS24585 Protein ID WP_000220560.1
Coordinates 23642..23923 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PO910_RS24590 Protein ID WP_000121743.1
Coordinates 23913..24164 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO910_RS24540 (PO910_24540) 18651..19142 - 492 WP_000872475.1 transcription termination/antitermination NusG family protein -
PO910_RS24545 (PO910_24545) 19503..20660 - 1158 WP_000538023.1 DNA distortion polypeptide 2 -
PO910_RS24550 (PO910_24550) 20663..21208 - 546 WP_038976855.1 DNA distortion polypeptide 1 -
PO910_RS24555 (PO910_24555) 21535..21807 - 273 WP_000160399.1 hypothetical protein -
PO910_RS24560 (PO910_24560) 21820..21969 - 150 WP_000003880.1 hypothetical protein -
PO910_RS24565 (PO910_24565) 22256..22585 - 330 WP_000866648.1 hypothetical protein -
PO910_RS24570 (PO910_24570) 22678..22893 - 216 WP_001180116.1 hypothetical protein -
PO910_RS24575 (PO910_24575) 22883..23128 - 246 WP_000356546.1 hypothetical protein -
PO910_RS24580 (PO910_24580) 23173..23496 - 324 WP_001181903.1 hypothetical protein -
PO910_RS24585 (PO910_24585) 23642..23923 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PO910_RS24590 (PO910_24590) 23913..24164 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PO910_RS24595 (PO910_24595) 25420..26256 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
PO910_RS24600 (PO910_24600) 26296..26742 + 447 WP_001074386.1 hypothetical protein -
PO910_RS24605 (PO910_24605) 26879..27232 + 354 WP_000876434.1 DNA distortion polypeptide 3 -
PO910_RS24610 (PO910_24610) 27292..28260 - 969 WP_166501310.1 IS5-like element IS903B family transposase -
PO910_RS24615 (PO910_24615) 28262..28555 - 294 WP_015060510.1 hypothetical protein -
PO910_RS24620 (PO910_24620) 28571..28801 - 231 WP_000051064.1 plasmid partition protein ParG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / lnu(F) / tet(X4) / floR / tet(A) / blaSHV-12 - 1..51555 51555


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T269645 WP_000220560.1 NZ_CP116984:c23923-23642 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT269645 WP_000121743.1 NZ_CP116984:c24164-23913 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References