Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 69761..70362 | Replicon | plasmid pE6474.2 |
Accession | NZ_CP116983 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | doc | Uniprot ID | F4TND7 |
Locus tag | PO910_RS24275 | Protein ID | WP_001216030.1 |
Coordinates | 69761..70141 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PO910_RS24280 | Protein ID | WP_001190712.1 |
Coordinates | 70141..70362 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS24245 (PO910_24245) | 64861..64980 | - | 120 | WP_001376634.1 | ash family protein | - |
PO910_RS24250 (PO910_24250) | 65202..66686 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
PO910_RS24255 (PO910_24255) | 66686..67879 | - | 1194 | WP_094320460.1 | terminase | - |
PO910_RS24260 (PO910_24260) | 67965..68417 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
PO910_RS24265 (PO910_24265) | 68506..69549 | - | 1044 | WP_069187067.1 | DUF968 domain-containing protein | - |
PO910_RS24270 (PO910_24270) | 69577..69756 | - | 180 | WP_001339207.1 | hypothetical protein | - |
PO910_RS24275 (PO910_24275) | 69761..70141 | - | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PO910_RS24280 (PO910_24280) | 70141..70362 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PO910_RS24285 (PO910_24285) | 70545..72101 | + | 1557 | WP_063856231.1 | type I restriction-modification system subunit M | - |
PO910_RS24290 (PO910_24290) | 72098..73381 | + | 1284 | WP_001617890.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..98542 | 98542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T269644 WP_001216030.1 NZ_CP116983:c70141-69761 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |