Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
| Location | 64046..64849 | Replicon | plasmid pE6474.1 |
| Accession | NZ_CP116982 | ||
| Organism | Escherichia coli strain E6474 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | G3CAI8 |
| Locus tag | PO910_RS23370 | Protein ID | WP_000348883.1 |
| Coordinates | 64046..64576 (-) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | G3CAI7 |
| Locus tag | PO910_RS23375 | Protein ID | WP_001275013.1 |
| Coordinates | 64580..64849 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO910_RS23340 (59714) | 59714..60490 | + | 777 | WP_039052454.1 | hypothetical protein | - |
| PO910_RS23345 (60492) | 60492..62756 | + | 2265 | WP_015060475.1 | UvrD-helicase domain-containing protein | - |
| PO910_RS23350 (63174) | 63174..63245 | - | 72 | Protein_59 | hypothetical protein | - |
| PO910_RS23355 (63229) | 63229..63459 | + | 231 | WP_001261274.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PO910_RS23360 (63456) | 63456..63772 | + | 317 | Protein_61 | type II toxin-antitoxin system VapC family toxin | - |
| PO910_RS23365 (63828) | 63828..64045 | - | 218 | Protein_62 | transposase | - |
| PO910_RS23370 (64046) | 64046..64576 | - | 531 | WP_000348883.1 | GNAT family N-acetyltransferase | Toxin |
| PO910_RS23375 (64580) | 64580..64849 | - | 270 | WP_001275013.1 | DUF1778 domain-containing protein | Antitoxin |
| PO910_RS23380 (65104) | 65104..65801 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| PO910_RS23385 (66075) | 66075..66618 | + | 544 | Protein_66 | fimbrial protein | - |
| PO910_RS23390 (66671) | 66671..67363 | + | 693 | WP_001223973.1 | molecular chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / sul3 | - | 1..156174 | 156174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20321.20 Da Isoelectric Point: 6.4889
>T269638 WP_000348883.1 NZ_CP116982:c64576-64046 [Escherichia coli]
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCDSL
FYPTKSIEVLFEVNDE
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCDSL
FYPTKSIEVLFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|