Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3228706..3229331 | Replicon | chromosome |
| Accession | NZ_CP116981 | ||
| Organism | Escherichia coli strain E6474 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PO910_RS15645 | Protein ID | WP_000911330.1 |
| Coordinates | 3228706..3229104 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | PO910_RS15650 | Protein ID | WP_000450524.1 |
| Coordinates | 3229104..3229331 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO910_RS15625 (3224613) | 3224613..3224813 | + | 201 | WP_124053586.1 | YpfN family protein | - |
| PO910_RS15630 (3224894) | 3224894..3225592 | - | 699 | WP_000679812.1 | esterase | - |
| PO910_RS15635 (3225666) | 3225666..3227681 | - | 2016 | WP_000829292.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| PO910_RS15640 (3227696) | 3227696..3228559 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| PO910_RS15645 (3228706) | 3228706..3229104 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PO910_RS15650 (3229104) | 3229104..3229331 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PO910_RS15655 (3229485) | 3229485..3230198 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PO910_RS15660 (3230411) | 3230411..3231445 | - | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
| PO910_RS15665 (3231462) | 3231462..3232340 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PO910_RS15670 (3232486) | 3232486..3233058 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| PO910_RS15675 (3233058) | 3233058..3233528 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T269632 WP_000911330.1 NZ_CP116981:c3229104-3228706 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|