Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2117656..2118294 | Replicon | chromosome |
Accession | NZ_CP116981 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PO910_RS10315 | Protein ID | WP_000813794.1 |
Coordinates | 2117656..2117832 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PO910_RS10320 | Protein ID | WP_001270286.1 |
Coordinates | 2117878..2118294 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS10295 (2113275) | 2113275..2114450 | - | 1176 | WP_001236215.1 | BenE family transporter YdcO | - |
PO910_RS10300 (2114542) | 2114542..2115078 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
PO910_RS10305 (2115151) | 2115151..2117112 | + | 1962 | WP_001593323.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PO910_RS10310 (2117204) | 2117204..2117434 | - | 231 | WP_000494244.1 | YncJ family protein | - |
PO910_RS10315 (2117656) | 2117656..2117832 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PO910_RS10320 (2117878) | 2117878..2118294 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PO910_RS10325 (2118373) | 2118373..2119778 | + | 1406 | Protein_2013 | PLP-dependent aminotransferase family protein | - |
PO910_RS10330 (2120023) | 2120023..2121168 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
PO910_RS10335 (2121186) | 2121186..2122199 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
PO910_RS10340 (2122200) | 2122200..2123141 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T269625 WP_000813794.1 NZ_CP116981:2117656-2117832 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269625 WP_001270286.1 NZ_CP116981:2117878-2118294 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|