Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1086717..1087335 | Replicon | chromosome |
Accession | NZ_CP116981 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PO910_RS05235 | Protein ID | WP_001291435.1 |
Coordinates | 1086717..1086935 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PO910_RS05240 | Protein ID | WP_000344800.1 |
Coordinates | 1086961..1087335 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS05200 (1082008) | 1082008..1082580 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
PO910_RS05205 (1082611) | 1082611..1082922 | - | 312 | WP_000409911.1 | MGMT family protein | - |
PO910_RS05215 (1083301) | 1083301..1083654 | + | 354 | WP_000878141.1 | DUF1428 family protein | - |
PO910_RS05220 (1083696) | 1083696..1085245 | - | 1550 | Protein_1014 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PO910_RS05225 (1085409) | 1085409..1085879 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PO910_RS05230 (1085995) | 1085995..1086546 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PO910_RS05235 (1086717) | 1086717..1086935 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PO910_RS05240 (1086961) | 1086961..1087335 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PO910_RS05245 (1087881) | 1087881..1091030 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PO910_RS05250 (1091053) | 1091053..1092246 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269617 WP_001291435.1 NZ_CP116981:c1086935-1086717 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269617 WP_000344800.1 NZ_CP116981:c1087335-1086961 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |