Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1052423..1053260 | Replicon | chromosome |
Accession | NZ_CP116981 | ||
Organism | Escherichia coli strain E6474 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PO910_RS05065 | Protein ID | WP_000227784.1 |
Coordinates | 1052423..1052965 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PO910_RS05070 | Protein ID | WP_001297137.1 |
Coordinates | 1052949..1053260 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO910_RS05045 (1047962) | 1047962..1048873 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
PO910_RS05050 (1049041) | 1049041..1049532 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PO910_RS05055 (1049660) | 1049660..1051024 | - | 1365 | WP_001000974.1 | MFS transporter | - |
PO910_RS05060 (1051432) | 1051432..1052367 | + | 936 | WP_001365761.1 | tetratricopeptide repeat protein | - |
PO910_RS05065 (1052423) | 1052423..1052965 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PO910_RS05070 (1052949) | 1052949..1053260 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PO910_RS05075 (1053445) | 1053445..1054335 | - | 891 | WP_000971336.1 | heme o synthase | - |
PO910_RS05080 (1054347) | 1054347..1054676 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PO910_RS05085 (1054676) | 1054676..1055290 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PO910_RS05090 (1055280) | 1055280..1057271 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PO910_RS05095 (1057293) | 1057293..1058240 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T269616 WP_000227784.1 NZ_CP116981:c1052965-1052423 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|