Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 23603..24125 Replicon plasmid pCUVM53-3
Accession NZ_CP116979
Organism Escherichia coli strain CUVM53

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQP10_RS24010 Protein ID WP_000220560.1
Coordinates 23603..23884 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQP10_RS24015 Protein ID WP_000121743.1
Coordinates 23874..24125 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP10_RS23965 (PQP10_23965) 18612..19103 - 492 WP_000872475.1 transcription termination/antitermination NusG family protein -
PQP10_RS23970 (PQP10_23970) 19464..20621 - 1158 WP_000538023.1 DNA distortion polypeptide 2 -
PQP10_RS23975 (PQP10_23975) 20624..21169 - 546 WP_038976855.1 DNA distortion polypeptide 1 -
PQP10_RS23980 (PQP10_23980) 21496..21768 - 273 WP_000160399.1 hypothetical protein -
PQP10_RS23985 (PQP10_23985) 21781..21930 - 150 WP_000003880.1 hypothetical protein -
PQP10_RS23990 (PQP10_23990) 22217..22546 - 330 WP_000866648.1 hypothetical protein -
PQP10_RS23995 (PQP10_23995) 22639..22854 - 216 WP_001180116.1 hypothetical protein -
PQP10_RS24000 (PQP10_24000) 22844..23089 - 246 WP_000356546.1 hypothetical protein -
PQP10_RS24005 (PQP10_24005) 23134..23457 - 324 WP_001181903.1 hypothetical protein -
PQP10_RS24010 (PQP10_24010) 23603..23884 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP10_RS24015 (PQP10_24015) 23874..24125 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQP10_RS24020 (PQP10_24020) 25381..26217 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
PQP10_RS24025 (PQP10_24025) 26257..26703 + 447 WP_001074386.1 hypothetical protein -
PQP10_RS24030 (PQP10_24030) 26840..27193 + 354 WP_000876434.1 DNA distortion polypeptide 3 -
PQP10_RS24035 (PQP10_24035) 27253..28221 - 969 WP_000654804.1 IS5-like element IS903B family transposase -
PQP10_RS24040 (PQP10_24040) 28223..28516 - 294 WP_015060510.1 hypothetical protein -
PQP10_RS24045 (PQP10_24045) 28532..28762 - 231 WP_000051064.1 plasmid partition protein ParG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / blaTEM-176 / tet(X4) / qnrS1 - 1..51743 51743


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T269612 WP_000220560.1 NZ_CP116979:c23884-23603 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT269612 WP_000121743.1 NZ_CP116979:c24125-23874 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References