Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 40528..41129 | Replicon | plasmid pCUVM53-2 |
| Accession | NZ_CP116978 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | PQP10_RS23580 | Protein ID | WP_001216039.1 |
| Coordinates | 40528..40908 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | PQP10_RS23585 | Protein ID | WP_001190711.1 |
| Coordinates | 40908..41129 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS23545 (PQP10_23545) | 35598..36629 | - | 1032 | WP_029393497.1 | site-specific integrase | - |
| PQP10_RS23550 (PQP10_23550) | 36637..36858 | - | 222 | WP_000542336.1 | hypothetical protein | - |
| PQP10_RS23555 (PQP10_23555) | 37455..37664 | + | 210 | WP_000874156.1 | hypothetical protein | - |
| PQP10_RS23560 (PQP10_23560) | 37775..38626 | + | 852 | WP_000611661.1 | phage repressor protein C1 | - |
| PQP10_RS23565 (PQP10_23565) | 38659..39057 | - | 399 | WP_229436862.1 | phage antirepressor KilAC domain-containing protein | - |
| PQP10_RS23570 (PQP10_23570) | 39273..40316 | - | 1044 | WP_069067567.1 | DUF968 domain-containing protein | - |
| PQP10_RS23575 (PQP10_23575) | 40344..40523 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| PQP10_RS23580 (PQP10_23580) | 40528..40908 | - | 381 | WP_001216039.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQP10_RS23585 (PQP10_23585) | 40908..41129 | - | 222 | WP_001190711.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP10_RS23590 (PQP10_23590) | 41394..42091 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| PQP10_RS23595 (PQP10_23595) | 42108..42434 | - | 327 | Protein_46 | hypothetical protein | - |
| PQP10_RS23600 (PQP10_23600) | 42507..43769 | - | 1263 | WP_069067570.1 | hypothetical protein | - |
| PQP10_RS23605 (PQP10_23605) | 44071..44772 | - | 702 | WP_272773067.1 | hypothetical protein | - |
| PQP10_RS23610 (PQP10_23610) | 44769..45317 | - | 549 | Protein_49 | metallophosphoesterase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(A) / blaTEM-176 / qnrS1 / aph(3'')-Ib / aph(6)-Id | - | 1..98110 | 98110 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13558.27 Da Isoelectric Point: 5.1514
>T269611 WP_001216039.1 NZ_CP116978:c40908-40528 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRAALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRAALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|