Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 40528..41129 Replicon plasmid pCUVM53-2
Accession NZ_CP116978
Organism Escherichia coli strain CUVM53

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag PQP10_RS23580 Protein ID WP_001216039.1
Coordinates 40528..40908 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag PQP10_RS23585 Protein ID WP_001190711.1
Coordinates 40908..41129 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP10_RS23545 (PQP10_23545) 35598..36629 - 1032 WP_029393497.1 site-specific integrase -
PQP10_RS23550 (PQP10_23550) 36637..36858 - 222 WP_000542336.1 hypothetical protein -
PQP10_RS23555 (PQP10_23555) 37455..37664 + 210 WP_000874156.1 hypothetical protein -
PQP10_RS23560 (PQP10_23560) 37775..38626 + 852 WP_000611661.1 phage repressor protein C1 -
PQP10_RS23565 (PQP10_23565) 38659..39057 - 399 WP_229436862.1 phage antirepressor KilAC domain-containing protein -
PQP10_RS23570 (PQP10_23570) 39273..40316 - 1044 WP_069067567.1 DUF968 domain-containing protein -
PQP10_RS23575 (PQP10_23575) 40344..40523 - 180 WP_000113018.1 hypothetical protein -
PQP10_RS23580 (PQP10_23580) 40528..40908 - 381 WP_001216039.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP10_RS23585 (PQP10_23585) 40908..41129 - 222 WP_001190711.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP10_RS23590 (PQP10_23590) 41394..42091 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
PQP10_RS23595 (PQP10_23595) 42108..42434 - 327 Protein_46 hypothetical protein -
PQP10_RS23600 (PQP10_23600) 42507..43769 - 1263 WP_069067570.1 hypothetical protein -
PQP10_RS23605 (PQP10_23605) 44071..44772 - 702 WP_272773067.1 hypothetical protein -
PQP10_RS23610 (PQP10_23610) 44769..45317 - 549 Protein_49 metallophosphoesterase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(A) / blaTEM-176 / qnrS1 / aph(3'')-Ib / aph(6)-Id - 1..98110 98110


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13558.27 Da        Isoelectric Point: 5.1514

>T269611 WP_001216039.1 NZ_CP116978:c40908-40528 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRAALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8134.08 Da        Isoelectric Point: 4.5843

>AT269611 WP_001190711.1 NZ_CP116978:c41129-40908 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVDR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References