Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 4569378..4570083 | Replicon | chromosome |
| Accession | NZ_CP116976 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | PQP10_RS22145 | Protein ID | WP_000539521.1 |
| Coordinates | 4569697..4570083 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PQP10_RS22140 | Protein ID | WP_001280945.1 |
| Coordinates | 4569378..4569707 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS22125 (4564535) | 4564535..4565446 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
| PQP10_RS22130 (4565624) | 4565624..4567972 | + | 2349 | WP_001338403.1 | EAL domain-containing protein | - |
| PQP10_RS22135 (4567980) | 4567980..4569308 | + | 1329 | WP_000086877.1 | GGDEF domain-containing protein | - |
| PQP10_RS22140 (4569378) | 4569378..4569707 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| PQP10_RS22145 (4569697) | 4569697..4570083 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP10_RS22150 (4570309) | 4570309..4571634 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| PQP10_RS22155 (4571847) | 4571847..4572230 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| PQP10_RS22160 (4572341) | 4572341..4573456 | + | 1116 | WP_000555031.1 | aldose sugar dehydrogenase YliI | - |
| PQP10_RS22165 (4573453) | 4573453..4574079 | - | 627 | WP_094337114.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T269604 WP_000539521.1 NZ_CP116976:c4570083-4569697 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|