Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3919184..3919838 | Replicon | chromosome |
| Accession | NZ_CP116976 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | PQP10_RS19000 | Protein ID | WP_000244777.1 |
| Coordinates | 3919431..3919838 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PQP10_RS18995 | Protein ID | WP_000354046.1 |
| Coordinates | 3919184..3919450 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS18970 (3914353) | 3914353..3915096 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
| PQP10_RS18975 (3915153) | 3915153..3916586 | - | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
| PQP10_RS18980 (3916631) | 3916631..3916942 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PQP10_RS18985 (3917106) | 3917106..3917765 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PQP10_RS18990 (3917961) | 3917961..3918941 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| PQP10_RS18995 (3919184) | 3919184..3919450 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PQP10_RS19000 (3919431) | 3919431..3919838 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| PQP10_RS19005 (3919878) | 3919878..3920399 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PQP10_RS19010 (3920511) | 3920511..3921407 | + | 897 | WP_000806639.1 | site-specific tyrosine recombinase XerD | - |
| PQP10_RS19015 (3921432) | 3921432..3922142 | + | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PQP10_RS19020 (3922148) | 3922148..3923881 | + | 1734 | WP_272771711.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T269600 WP_000244777.1 NZ_CP116976:3919431-3919838 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |