Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3816550..3817351 | Replicon | chromosome |
| Accession | NZ_CP116976 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PQP10_RS18485 | Protein ID | WP_064143481.1 |
| Coordinates | 3816550..3816927 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PQP10_RS18490 | Protein ID | WP_064143482.1 |
| Coordinates | 3816974..3817351 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS18450 (3811631) | 3811631..3812230 | + | 600 | WP_001255034.1 | type II secretion system minor pseudopilin GspJ | - |
| PQP10_RS18455 (3812233) | 3812233..3813210 | + | 978 | WP_000633209.1 | type II secretion system minor pseudopilin GspK | - |
| PQP10_RS18460 (3813207) | 3813207..3814385 | + | 1179 | WP_000094962.1 | type II secretion system protein GspL | - |
| PQP10_RS18465 (3814387) | 3814387..3814923 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| PQP10_RS18470 (3815204) | 3815204..3816046 | - | 843 | WP_064143480.1 | DUF4942 domain-containing protein | - |
| PQP10_RS18475 (3816131) | 3816131..3816328 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| PQP10_RS18480 (3816404) | 3816404..3816553 | - | 150 | Protein_3598 | DUF5983 family protein | - |
| PQP10_RS18485 (3816550) | 3816550..3816927 | - | 378 | WP_064143481.1 | TA system toxin CbtA family protein | Toxin |
| PQP10_RS18490 (3816974) | 3816974..3817351 | - | 378 | WP_064143482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PQP10_RS18495 (3817431) | 3817431..3817652 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| PQP10_RS18500 (3817715) | 3817715..3818191 | - | 477 | WP_064143483.1 | RadC family protein | - |
| PQP10_RS18505 (3818207) | 3818207..3818692 | - | 486 | WP_000214414.1 | antirestriction protein | - |
| PQP10_RS18510 (3818784) | 3818784..3819602 | - | 819 | WP_113387975.1 | DUF932 domain-containing protein | - |
| PQP10_RS18515 (3819693) | 3819693..3819926 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.93 Da Isoelectric Point: 7.2922
>T269599 WP_064143481.1 NZ_CP116976:c3816927-3816550 [Escherichia coli]
MKTLPDTHEREASRCSSPVTIWQTLLARLLGQHYSLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
GTCAHSQLINSIDILRARRATGLLTRSNYRTVNDIIRGKDAEAKQ
MKTLPDTHEREASRCSSPVTIWQTLLARLLGQHYSLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
GTCAHSQLINSIDILRARRATGLLTRSNYRTVNDIIRGKDAEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13751.48 Da Isoelectric Point: 5.4906
>AT269599 WP_064143482.1 NZ_CP116976:c3817351-3816974 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSNADAYHLDQAFPLLLKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSWGYVYMAVYPTPAAPATTA
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSNADAYHLDQAFPLLLKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSWGYVYMAVYPTPAAPATTA
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|