Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 582256..582894 | Replicon | chromosome |
Accession | NZ_CP116976 | ||
Organism | Escherichia coli strain CUVM53 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PQP10_RS02890 | Protein ID | WP_000813794.1 |
Coordinates | 582256..582432 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PQP10_RS02895 | Protein ID | WP_001270286.1 |
Coordinates | 582478..582894 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP10_RS02870 (577875) | 577875..579050 | - | 1176 | WP_272772226.1 | BenE family transporter YdcO | - |
PQP10_RS02875 (579142) | 579142..579678 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
PQP10_RS02880 (579751) | 579751..581712 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PQP10_RS02885 (581804) | 581804..582034 | - | 231 | WP_000494244.1 | YncJ family protein | - |
PQP10_RS02890 (582256) | 582256..582432 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PQP10_RS02895 (582478) | 582478..582894 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PQP10_RS02900 (582973) | 582973..584379 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
PQP10_RS02905 (584624) | 584624..585769 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
PQP10_RS02910 (585787) | 585787..586800 | + | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
PQP10_RS02915 (586801) | 586801..587742 | + | 942 | WP_001251313.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T269588 WP_000813794.1 NZ_CP116976:582256-582432 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269588 WP_001270286.1 NZ_CP116976:582478-582894 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|