Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 208279..209111 | Replicon | chromosome |
| Accession | NZ_CP116976 | ||
| Organism | Escherichia coli strain CUVM53 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | F4TJC5 |
| Locus tag | PQP10_RS01010 | Protein ID | WP_001094452.1 |
| Coordinates | 208737..209111 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PQP10_RS01005 | Protein ID | WP_112019398.1 |
| Coordinates | 208279..208647 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP10_RS00980 (205375) | 205375..205570 | + | 196 | Protein_193 | DUF905 family protein | - |
| PQP10_RS00985 (205687) | 205687..206505 | + | 819 | WP_075362641.1 | DUF932 domain-containing protein | - |
| PQP10_RS00990 (206847) | 206847..207320 | + | 474 | WP_075362640.1 | antirestriction protein | - |
| PQP10_RS00995 (207336) | 207336..207812 | + | 477 | WP_001186770.1 | RadC family protein | - |
| PQP10_RS01000 (207881) | 207881..208102 | + | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| PQP10_RS01005 (208279) | 208279..208647 | + | 369 | WP_112019398.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PQP10_RS01010 (208737) | 208737..209111 | + | 375 | WP_001094452.1 | TA system toxin CbtA family protein | Toxin |
| PQP10_RS01015 (209108) | 209108..209599 | + | 492 | WP_143359947.1 | DUF5983 family protein | - |
| PQP10_RS01020 (209611) | 209611..209808 | + | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
| PQP10_RS01025 (209905) | 209905..210747 | + | 843 | WP_063082311.1 | DUF4942 domain-containing protein | - |
| PQP10_RS01035 (211218) | 211218..212156 | + | 939 | WP_000351315.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| PQP10_RS01040 (212211) | 212211..212948 | + | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| PQP10_RS01045 (212972) | 212972..213526 | + | 555 | WP_001001902.1 | molecular chaperone YcdY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14014.86 Da Isoelectric Point: 7.2920
>T269587 WP_001094452.1 NZ_CP116976:208737-209111 [Escherichia coli]
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|