Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 53050..53572 Replicon plasmid pCUVM3.5
Accession NZ_CP116975
Organism Escherichia coli strain CUVM3

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag PQP09_RS26855 Protein ID WP_000638823.1
Coordinates 53050..53331 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag PQP09_RS26860 Protein ID WP_000121741.1
Coordinates 53321..53572 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP09_RS26820 (PQP09_26820) 49199..49519 - 321 WP_000362080.1 VirB3 family type IV secretion system protein -
PQP09_RS26825 (PQP09_26825) 49590..49880 - 291 WP_000865479.1 conjugal transfer protein -
PQP09_RS26830 (PQP09_26830) 49880..50464 - 585 WP_001177113.1 lytic transglycosylase domain-containing protein -
PQP09_RS26835 (PQP09_26835) 50485..50883 - 399 WP_001153665.1 hypothetical protein -
PQP09_RS26840 (PQP09_26840) 51002..51439 - 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
PQP09_RS26845 (PQP09_26845) 51445..52680 - 1236 WP_015059538.1 TcpQ domain-containing protein -
PQP09_RS26850 (PQP09_26850) 52683..52982 - 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
PQP09_RS26855 (PQP09_26855) 53050..53331 - 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP09_RS26860 (PQP09_26860) 53321..53572 - 252 WP_000121741.1 hypothetical protein Antitoxin
PQP09_RS26865 (PQP09_26865) 53672..54307 - 636 WP_015059536.1 hypothetical protein -
PQP09_RS26870 (PQP09_26870) 54380..54667 - 288 WP_001032611.1 EexN family lipoprotein -
PQP09_RS26875 (PQP09_26875) 54680..54934 - 255 WP_001043555.1 EexN family lipoprotein -
PQP09_RS26880 (PQP09_26880) 54936..55577 - 642 WP_001425343.1 type IV secretion system protein -
PQP09_RS26885 (PQP09_26885) 55583..56578 - 996 WP_001028543.1 type IV secretion system protein -
PQP09_RS26890 (PQP09_26890) 56582..56839 - 258 WP_000739144.1 hypothetical protein -
PQP09_RS26895 (PQP09_26895) 56836..57138 - 303 WP_001360345.1 hypothetical protein -
PQP09_RS26900 (PQP09_26900) 57119..57376 - 258 WP_001542015.1 hypothetical protein -
PQP09_RS26905 (PQP09_26905) 57409..57855 - 447 WP_001243165.1 hypothetical protein -
PQP09_RS26910 (PQP09_26910) 57866..58036 - 171 WP_000550720.1 hypothetical protein -
PQP09_RS26915 (PQP09_26915) 58040..58483 - 444 WP_000964330.1 NfeD family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62582 62582


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T269586 WP_000638823.1 NZ_CP116975:c53331-53050 [Escherichia coli]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT269586 WP_000121741.1 NZ_CP116975:c53572-53321 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References