269585

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 7032..7533 Replicon plasmid pCUVM3.5
Accession NZ_CP116975
Organism Escherichia coli strain CUVM3

Toxin (Protein)


Gene name TsxA Uniprot ID H1ZXU8
Locus tag PQP09_RS26615 Protein ID WP_000702247.1
Coordinates 7032..7292 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag PQP09_RS26620 Protein ID WP_001132407.1
Coordinates 7282..7533 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP09_RS26570 (PQP09_26570) 2570..2722 + 153 Protein_2 DUF5431 family protein -
PQP09_RS26575 (PQP09_26575) 2667..2789 + 123 WP_223170659.1 type I toxin-antitoxin system Hok family toxin -
PQP09_RS26580 (PQP09_26580) 2939..3535 + 597 WP_000125165.1 ProQ/FINO family protein -
PQP09_RS26585 (PQP09_26585) 3553..3837 - 285 WP_001162371.1 hypothetical protein -
PQP09_RS26590 (PQP09_26590) 3911..4576 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
PQP09_RS26595 (PQP09_26595) 5174..5503 + 330 WP_000855120.1 hypothetical protein -
PQP09_RS26600 (PQP09_26600) 6085..6408 + 324 WP_000427403.1 hypothetical protein -
PQP09_RS26605 (PQP09_26605) 6450..6659 + 210 WP_000866036.1 hypothetical protein -
PQP09_RS26610 (PQP09_26610) 6756..6980 + 225 WP_000814381.1 hypothetical protein -
PQP09_RS26615 (PQP09_26615) 7032..7292 + 261 WP_000702247.1 hypothetical protein Toxin
PQP09_RS26620 (PQP09_26620) 7282..7533 + 252 WP_001132407.1 transcriptional regulator Antitoxin
PQP09_RS26625 (PQP09_26625) 8083..8361 + 279 WP_000545938.1 hypothetical protein -
PQP09_RS26630 (PQP09_26630) 8781..9047 + 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
PQP09_RS26635 (PQP09_26635) 9154..9597 - 444 WP_000068545.1 hypothetical protein -
PQP09_RS26640 (PQP09_26640) 9894..10076 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
PQP09_RS26645 (PQP09_26645) 10101..10538 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
PQP09_RS26650 (PQP09_26650) 10669..10995 - 327 WP_063078684.1 hypothetical protein -
PQP09_RS26655 (PQP09_26655) 11015..11722 - 708 WP_021503228.1 hypothetical protein -
PQP09_RS26660 (PQP09_26660) 11724..12476 - 753 WP_000797966.1 conjugal transfer protein TraL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62582 62582


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9817.29 Da        Isoelectric Point: 10.0665

>T269585 WP_000702247.1 NZ_CP116975:7032-7292 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT269585 WP_001132407.1 NZ_CP116975:7282-7533 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1P8DNC0

Antitoxin

Source ID Structure

References