Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 152585..153110 | Replicon | plasmid pCUVM3.1 |
Accession | NZ_CP116971 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | PQP09_RS24910 | Protein ID | WP_001159871.1 |
Coordinates | 152585..152890 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | Q3ZU16 |
Locus tag | PQP09_RS24915 | Protein ID | WP_000813639.1 |
Coordinates | 152892..153110 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS24885 (147587) | 147587..148558 | - | 972 | WP_032248840.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
PQP09_RS24890 (148558) | 148558..149724 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
PQP09_RS24895 (150312) | 150312..150485 | - | 174 | Protein_167 | RepB family plasmid replication initiator protein | - |
PQP09_RS24905 (151920) | 151920..152584 | - | 665 | Protein_169 | site-specific integrase | - |
PQP09_RS24910 (152585) | 152585..152890 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PQP09_RS24915 (152892) | 152892..153110 | - | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PQP09_RS24920 (153927) | 153927..154217 | - | 291 | WP_032248853.1 | hypothetical protein | - |
PQP09_RS24925 (154214) | 154214..155341 | - | 1128 | WP_032248854.1 | DUF4238 domain-containing protein | - |
PQP09_RS24930 (155375) | 155375..156898 | - | 1524 | WP_227464009.1 | hypothetical protein | - |
PQP09_RS24935 (157175) | 157175..157651 | - | 477 | WP_032248785.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..164599 | 164599 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T269578 WP_001159871.1 NZ_CP116971:c152890-152585 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9DIR5 |