Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 103449..104074 | Replicon | plasmid pCUVM3.1 |
Accession | NZ_CP116971 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQP09_RS24595 | Protein ID | WP_000911313.1 |
Coordinates | 103676..104074 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | PQP09_RS24590 | Protein ID | WP_000450532.1 |
Coordinates | 103449..103676 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS24590 (103449) | 103449..103676 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQP09_RS24595 (103676) | 103676..104074 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQP09_RS24600 (104083) | 104083..106236 | - | 2154 | WP_072664524.1 | type IV conjugative transfer system coupling protein TraD | - |
PQP09_RS24605 (106489) | 106489..107220 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
PQP09_RS24610 (107252) | 107252..107749 | - | 498 | WP_000605859.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..164599 | 164599 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T269574 WP_000911313.1 NZ_CP116971:103676-104074 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|