Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 87579..88126 Replicon plasmid pCUVM3.1
Accession NZ_CP116971
Organism Escherichia coli strain CUVM3

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag PQP09_RS24500 Protein ID WP_001384452.1
Coordinates 87579..87857 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2H4TKU7
Locus tag PQP09_RS24505 Protein ID WP_000079923.1
Coordinates 87857..88126 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP09_RS24470 (83497) 83497..83805 - 309 Protein_82 integrase core domain-containing protein -
PQP09_RS24475 (83822) 83822..84898 - 1077 WP_000227970.1 IS110 family transposase -
PQP09_RS24480 (85180) 85180..85776 - 597 Protein_84 IS3 family transposase -
PQP09_RS24485 (85785) 85785..86936 - 1152 WP_272784612.1 IS30-like element IS30 family transposase -
PQP09_RS24490 (87004) 87004..87306 - 303 Protein_86 transposase -
PQP09_RS24495 (87342) 87342..87539 - 198 Protein_87 3'-5' exonuclease -
PQP09_RS24500 (87579) 87579..87857 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
PQP09_RS24505 (87857) 87857..88126 - 270 WP_000079923.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PQP09_RS24510 (88199) 88199..88339 - 141 WP_162777809.1 hypothetical protein -
PQP09_RS24515 (89033) 89033..89889 - 857 Protein_91 incFII family plasmid replication initiator RepA -
PQP09_RS24520 (89882) 89882..89956 - 75 WP_001365705.1 RepA leader peptide Tap -
PQP09_RS24525 (90005) 90005..90130 + 126 WP_001436741.1 hypothetical protein -
PQP09_RS24530 (90203) 90203..90451 - 249 WP_000083838.1 replication regulatory protein RepA -
PQP09_RS24535 (90735) 90735..90884 - 150 WP_074152653.1 Hok/Gef family protein -
- (90928) 90928..90989 + 62 NuclAT_1 - -
- (90928) 90928..90989 + 62 NuclAT_1 - -
- (90928) 90928..90989 + 62 NuclAT_1 - -
- (90928) 90928..90989 + 62 NuclAT_1 - -
PQP09_RS24540 (91248) 91248..91547 - 300 WP_050593763.1 hypothetical protein -
PQP09_RS24545 (91665) 91665..92111 - 447 WP_063115548.1 thermonuclease family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..164599 164599
- inside IScluster/Tn - - 83497..94665 11168


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T269572 WP_001384452.1 NZ_CP116971:c87857-87579 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10196.52 Da        Isoelectric Point: 7.2050

>AT269572 WP_000079923.1 NZ_CP116971:c88126-87857 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVEQQHNTWFRDQVAAGRQQLERGDVLPHDMVESSATAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A2H4TKU7

References