Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4362948..4363566 | Replicon | chromosome |
Accession | NZ_CP116970 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PQP09_RS21470 | Protein ID | WP_001291435.1 |
Coordinates | 4362948..4363166 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PQP09_RS21475 | Protein ID | WP_000344800.1 |
Coordinates | 4363192..4363566 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS21435 (4358237) | 4358237..4358809 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
PQP09_RS21440 (4358840) | 4358840..4359151 | - | 312 | WP_000409911.1 | MGMT family protein | - |
PQP09_RS21450 (4359530) | 4359530..4359883 | + | 354 | WP_000878141.1 | DUF1428 family protein | - |
PQP09_RS21455 (4359925) | 4359925..4361475 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PQP09_RS21460 (4361639) | 4361639..4362109 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PQP09_RS21465 (4362225) | 4362225..4362776 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PQP09_RS21470 (4362948) | 4362948..4363166 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PQP09_RS21475 (4363192) | 4363192..4363566 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PQP09_RS21480 (4364112) | 4364112..4367261 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PQP09_RS21485 (4367284) | 4367284..4368477 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T269571 WP_001291435.1 NZ_CP116970:c4363166-4362948 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT269571 WP_000344800.1 NZ_CP116970:c4363566-4363192 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |