Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4328651..4329488 | Replicon | chromosome |
Accession | NZ_CP116970 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | PQP09_RS21300 | Protein ID | WP_096262872.1 |
Coordinates | 4328651..4329193 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PQP09_RS21305 | Protein ID | WP_001297137.1 |
Coordinates | 4329177..4329488 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS21280 (4324190) | 4324190..4325101 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
PQP09_RS21285 (4325269) | 4325269..4325760 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PQP09_RS21290 (4325888) | 4325888..4327252 | - | 1365 | WP_001000978.1 | MFS transporter | - |
PQP09_RS21295 (4327660) | 4327660..4328595 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
PQP09_RS21300 (4328651) | 4328651..4329193 | - | 543 | WP_096262872.1 | GNAT family N-acetyltransferase | Toxin |
PQP09_RS21305 (4329177) | 4329177..4329488 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PQP09_RS21310 (4329673) | 4329673..4330563 | - | 891 | WP_000971336.1 | heme o synthase | - |
PQP09_RS21315 (4330575) | 4330575..4330904 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PQP09_RS21320 (4330904) | 4330904..4331518 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PQP09_RS21325 (4331508) | 4331508..4333499 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PQP09_RS21330 (4333521) | 4333521..4334468 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19804.03 Da Isoelectric Point: 8.6178
>T269570 WP_096262872.1 NZ_CP116970:c4329193-4328651 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSNITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSNITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|