Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3747548..3748346 Replicon chromosome
Accession NZ_CP116970
Organism Escherichia coli strain CUVM3

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag PQP09_RS18545 Protein ID WP_000854919.1
Coordinates 3747969..3748346 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag PQP09_RS18540 Protein ID WP_001285608.1
Coordinates 3747548..3747922 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP09_RS18500 (3743272) 3743272..3743952 + 681 WP_001282919.1 WYL domain-containing protein -
PQP09_RS18505 (3744100) 3744100..3744777 + 678 WP_001097301.1 hypothetical protein -
PQP09_RS18510 (3744783) 3744783..3745016 + 234 WP_001278293.1 DUF905 family protein -
PQP09_RS18515 (3745106) 3745106..3745924 + 819 WP_001175165.1 DUF932 domain-containing protein -
PQP09_RS18520 (3745950) 3745950..3746090 - 141 WP_000997937.1 hypothetical protein -
PQP09_RS18525 (3746190) 3746190..3746669 + 480 WP_000706980.1 antirestriction protein -
PQP09_RS18530 (3746684) 3746684..3747160 + 477 WP_001560293.1 RadC family protein -
PQP09_RS18535 (3747247) 3747247..3747468 + 222 WP_112021664.1 DUF987 domain-containing protein -
PQP09_RS18540 (3747548) 3747548..3747922 + 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PQP09_RS18545 (3747969) 3747969..3748346 + 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
PQP09_RS18550 (3748343) 3748343..3748831 + 489 WP_000777664.1 DUF5983 family protein -
PQP09_RS18555 (3748851) 3748851..3749048 + 198 WP_001327226.1 DUF957 domain-containing protein -
PQP09_RS18560 (3749133) 3749133..3749234 + 102 Protein_3612 hypothetical protein -
PQP09_RS18565 (3750044) 3750044..3750187 - 144 Protein_3613 HNH endonuclease -
PQP09_RS18570 (3750287) 3750287..3750391 + 105 Protein_3614 HNH endonuclease -
PQP09_RS18575 (3750399) 3750399..3751379 - 981 WP_000379695.1 sialate O-acetylesterase -
PQP09_RS18580 (3751444) 3751444..3752550 - 1107 WP_001044128.1 N-acetylneuraminate epimerase -
PQP09_RS18585 (3752570) 3752570..3753286 - 717 WP_001295734.1 N-acetylneuraminic acid outer membrane channel NanC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - papD / papC / fimB / fimE / fimA / fimI / fimC 3722577..3760148 37571


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T269568 WP_000854919.1 NZ_CP116970:3747969-3748346 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT269568 WP_001285608.1 NZ_CP116970:3747548-3747922 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References