Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2198742..2199396 | Replicon | chromosome |
Accession | NZ_CP116970 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | PQP09_RS11005 | Protein ID | WP_000244781.1 |
Coordinates | 2198742..2199149 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | PQP09_RS11010 | Protein ID | WP_139501106.1 |
Coordinates | 2199130..2199396 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS10985 (2194699) | 2194699..2196432 | - | 1734 | WP_096262898.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PQP09_RS10990 (2196438) | 2196438..2197148 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQP09_RS10995 (2197173) | 2197173..2198069 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PQP09_RS11000 (2198181) | 2198181..2198702 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
PQP09_RS11005 (2198742) | 2198742..2199149 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
PQP09_RS11010 (2199130) | 2199130..2199396 | - | 267 | WP_139501106.1 | FAD assembly factor SdhE | Antitoxin |
PQP09_RS11015 (2199639) | 2199639..2200619 | + | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
PQP09_RS11020 (2200696) | 2200696..2201355 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PQP09_RS11025 (2201519) | 2201519..2201830 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
PQP09_RS11030 (2201875) | 2201875..2203308 | + | 1434 | WP_139501107.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T269562 WP_000244781.1 NZ_CP116970:c2199149-2198742 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|