Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2070281..2070864 | Replicon | chromosome |
Accession | NZ_CP116970 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | PQP09_RS10460 | Protein ID | WP_000254738.1 |
Coordinates | 2070281..2070616 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PQP09_RS10465 | Protein ID | WP_000581937.1 |
Coordinates | 2070616..2070864 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS10445 (2066168) | 2066168..2067466 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PQP09_RS10450 (2067554) | 2067554..2069191 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
PQP09_RS10455 (2069419) | 2069419..2070210 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PQP09_RS10460 (2070281) | 2070281..2070616 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
PQP09_RS10465 (2070616) | 2070616..2070864 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PQP09_RS10470 (2070942) | 2070942..2073176 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
PQP09_RS10475 (2073224) | 2073224..2074525 | - | 1302 | WP_000046814.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2064715..2066043 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T269561 WP_000254738.1 NZ_CP116970:c2070616-2070281 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|