Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 741107..741745 | Replicon | chromosome |
Accession | NZ_CP116970 | ||
Organism | Escherichia coli strain CUVM3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PQP09_RS03575 | Protein ID | WP_000813794.1 |
Coordinates | 741569..741745 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PQP09_RS03570 | Protein ID | WP_001270286.1 |
Coordinates | 741107..741523 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP09_RS03550 (736259) | 736259..737200 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
PQP09_RS03555 (737201) | 737201..738214 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
PQP09_RS03560 (738232) | 738232..739377 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
PQP09_RS03565 (739622) | 739622..741028 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
PQP09_RS03570 (741107) | 741107..741523 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PQP09_RS03575 (741569) | 741569..741745 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PQP09_RS03580 (741967) | 741967..742197 | + | 231 | WP_000494239.1 | YncJ family protein | - |
PQP09_RS03585 (742289) | 742289..744250 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PQP09_RS03590 (744323) | 744323..744859 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
PQP09_RS03595 (744951) | 744951..746126 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T269559 WP_000813794.1 NZ_CP116970:c741745-741569 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT269559 WP_001270286.1 NZ_CP116970:c741523-741107 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|