Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 12173..13310 | Replicon | plasmid pDM86-poxtA |
Accession | NZ_CP116965 | ||
Organism | Enterococcus faecalis strain DM86 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PO880_RS15230 | Protein ID | WP_100185210.1 |
Coordinates | 12447..13310 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | PO880_RS15225 | Protein ID | WP_000301765.1 |
Coordinates | 12173..12445 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO880_RS15200 (PO880_15200) | 7898..8068 | + | 171 | WP_000713595.1 | hypothetical protein | - |
PO880_RS15205 (PO880_15205) | 8082..8699 | + | 618 | WP_002295591.1 | recombinase family protein | - |
PO880_RS15210 (PO880_15210) | 8699..10843 | + | 2145 | WP_225001404.1 | type IA DNA topoisomerase | - |
PO880_RS15215 (PO880_15215) | 10946..11842 | + | 897 | WP_002304405.1 | ParA family protein | - |
PO880_RS15220 (PO880_15220) | 11941..12156 | + | 216 | WP_002295735.1 | peptide-binding protein | - |
PO880_RS15225 (PO880_15225) | 12173..12445 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
PO880_RS15230 (PO880_15230) | 12447..13310 | + | 864 | WP_100185210.1 | zeta toxin family protein | Toxin |
PO880_RS15235 (PO880_15235) | 13751..14068 | + | 318 | WP_002338433.1 | hypothetical protein | - |
PO880_RS15240 (PO880_15240) | 14088..14585 | + | 498 | WP_010713926.1 | molecular chaperone DnaJ | - |
PO880_RS15245 (PO880_15245) | 14619..14924 | + | 306 | WP_070544069.1 | hypothetical protein | - |
PO880_RS15250 (PO880_15250) | 14947..15204 | - | 258 | WP_000002668.1 | hypothetical protein | - |
PO880_RS15255 (PO880_15255) | 15207..15506 | - | 300 | WP_002325624.1 | hypothetical protein | - |
PO880_RS15260 (PO880_15260) | 15789..17783 | + | 1995 | WP_272731748.1 | MobQ family relaxase | - |
PO880_RS15265 (PO880_15265) | 17807..18139 | + | 333 | WP_000713503.1 | CagC family type IV secretion system protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | poxtA / Cfr(D) | - | 1..33351 | 33351 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32416.95 Da Isoelectric Point: 6.6610
>T269553 WP_100185210.1 NZ_CP116965:12447-13310 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|