Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 51091..51662 Replicon plasmid pDM86-cfr
Accession NZ_CP116963
Organism Enterococcus faecalis strain DM86

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag PO880_RS14615 Protein ID WP_002394791.1
Coordinates 51321..51662 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PO880_RS14610 Protein ID WP_002362431.1
Coordinates 51091..51321 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO880_RS14575 (46202) 46202..46453 - 252 WP_064686964.1 hypothetical protein -
PO880_RS14580 (46546) 46546..46674 + 129 WP_258076850.1 hypothetical protein -
PO880_RS14585 (47064) 47064..48860 - 1797 WP_064686966.1 AIPR family protein -
PO880_RS14590 (49064) 49064..49264 - 201 WP_064686967.1 hypothetical protein -
PO880_RS14595 (49748) 49748..49969 - 222 WP_080474121.1 hypothetical protein -
PO880_RS14600 (49966) 49966..50250 - 285 WP_064686968.1 hypothetical protein -
PO880_RS14605 (50267) 50267..50887 - 621 WP_231433215.1 recombinase family protein -
PO880_RS14610 (51091) 51091..51321 + 231 WP_002362431.1 hypothetical protein Antitoxin
PO880_RS14615 (51321) 51321..51662 + 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PO880_RS14620 (51774) 51774..52712 + 939 WP_002394789.1 hypothetical protein -
PO880_RS14625 (52980) 52980..53582 + 603 WP_002367780.1 Fic family protein -
PO880_RS14630 (53710) 53710..54390 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
PO880_RS14635 (54464) 54464..54598 + 135 Protein_59 ATP-binding protein -
PO880_RS14640 (54842) 54842..55021 + 180 WP_013356267.1 hypothetical protein -
PO880_RS14645 (55140) 55140..56189 + 1050 WP_001010505.1 23S rRNA (adenine(2503)-C(8))-methyltransferase Cfr -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid cfr EF0485 / prgB/asc10 1..88918 88918
- flank IS/Tn cfr - 53710..56189 2479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T269548 WP_002394791.1 NZ_CP116963:51321-51662 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT269548 WP_002362431.1 NZ_CP116963:51091-51321 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References