269543

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1257002..1257696 Replicon chromosome
Accession NZ_CP116962
Organism Enterococcus faecalis strain DM86

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag PO880_RS05900 Protein ID WP_033918698.1
Coordinates 1257002..1257346 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag PO880_RS05905 Protein ID WP_016627611.1
Coordinates 1257364..1257696 (-) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PO880_RS05870 (1252281) 1252281..1253249 + 969 WP_002364362.1 competence type IV pilus ATPase ComGA -
PO880_RS05875 (1253206) 1253206..1254252 + 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
PO880_RS05880 (1254252) 1254252..1254527 + 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
PO880_RS05885 (1254524) 1254524..1254967 + 444 WP_272731662.1 competence type IV pilus minor pilin ComGD -
PO880_RS05890 (1254995) 1254995..1256143 - 1149 WP_033918700.1 site-specific integrase -
PO880_RS05895 (1256240) 1256240..1256968 - 729 WP_033918699.1 potassium channel family protein -
PO880_RS05900 (1257002) 1257002..1257346 - 345 WP_033918698.1 ImmA/IrrE family metallo-endopeptidase Toxin
PO880_RS05905 (1257364) 1257364..1257696 - 333 WP_016627611.1 helix-turn-helix transcriptional regulator Antitoxin
PO880_RS05910 (1257985) 1257985..1258176 + 192 WP_010712202.1 hypothetical protein -
PO880_RS05915 (1258188) 1258188..1258499 + 312 WP_016617789.1 hypothetical protein -
PO880_RS05920 (1258515) 1258515..1258736 + 222 WP_229294412.1 aspartate decarboxylase -
PO880_RS05925 (1258733) 1258733..1258921 + 189 WP_033918697.1 hypothetical protein -
PO880_RS05930 (1258989) 1258989..1259309 + 321 WP_033918696.1 hypothetical protein -
PO880_RS05935 (1259309) 1259309..1259533 + 225 WP_033918695.1 hypothetical protein -
PO880_RS05940 (1259536) 1259536..1259892 + 357 WP_033918694.1 hypothetical protein -
PO880_RS05945 (1259985) 1259985..1260956 + 972 WP_033918693.1 RecT family recombinase -
PO880_RS05950 (1260919) 1260919..1261734 + 816 WP_033918692.1 PD-(D/E)XK nuclease-like domain-containing protein -
PO880_RS05955 (1261749) 1261749..1262528 + 780 WP_272731664.1 DnaD domain protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1254551..1302462 47911


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(12-64)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13718.69 Da        Isoelectric Point: 6.1372

>T269543 WP_033918698.1 NZ_CP116962:c1257346-1257002 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHEGQFNYSNVVTHYNLKMGQETYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12551.16 Da        Isoelectric Point: 5.2341

>AT269543 WP_016627611.1 NZ_CP116962:c1257696-1257364 [Enterococcus faecalis]
MTVFEIIQMLAKKQGKSVKDVSRELGFGESTIYKWKKQSPKAEYIEKVAQYFNVSTDYLLGRTDNPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References