Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 276500..277071 | Replicon | chromosome |
| Accession | NZ_CP116962 | ||
| Organism | Enterococcus faecalis strain DM86 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PO880_RS01290 | Protein ID | WP_010710856.1 |
| Coordinates | 276730..277071 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | PO880_RS01285 | Protein ID | WP_002354773.1 |
| Coordinates | 276500..276730 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO880_RS01265 (271717) | 271717..273333 | - | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
| PO880_RS01270 (274018) | 274018..274656 | + | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| PO880_RS01275 (274823) | 274823..275815 | - | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PO880_RS01280 (275954) | 275954..276169 | + | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PO880_RS01285 (276500) | 276500..276730 | + | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| PO880_RS01290 (276730) | 276730..277071 | + | 342 | WP_010710856.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PO880_RS01295 (277442) | 277442..281056 | + | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.47 Da Isoelectric Point: 9.3988
>T269532 WP_010710856.1 NZ_CP116962:276730-277071 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|