Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | sezT-pezT/zeta-couple_hipB |
Location | 1531719..1532983 | Replicon | chromosome |
Accession | NZ_CP116958 | ||
Organism | Streptococcus pasteurianus strain WUSP074 |
Toxin (Protein)
Gene name | sezT | Uniprot ID | A0A8B2XHR8 |
Locus tag | M0P28_RS07820 | Protein ID | WP_001235246.1 |
Coordinates | 1531719..1532507 (-) | Length | 263 a.a. |
Antitoxin (Protein)
Gene name | pezT | Uniprot ID | - |
Locus tag | M0P28_RS07825 | Protein ID | WP_000578720.1 |
Coordinates | 1532507..1532983 (-) | Length | 159 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M0P28_RS07795 (M0P28_07795) | 1526784..1527149 | - | 366 | WP_000431640.1 | MobC family plasmid mobilization relaxosome protein | - |
M0P28_RS07800 (M0P28_07800) | 1527152..1527514 | - | 363 | WP_000140674.1 | SAG1252 family conjugative relaxosome accessory protein | - |
M0P28_RS07805 (M0P28_07805) | 1528217..1528444 | - | 228 | WP_223875823.1 | hypothetical protein | - |
M0P28_RS07810 (M0P28_07810) | 1528441..1529982 | - | 1542 | WP_001279803.1 | UvrD-helicase domain-containing protein | - |
M0P28_RS07815 (M0P28_07815) | 1529975..1531729 | - | 1755 | WP_000394601.1 | AAA family ATPase | - |
M0P28_RS07820 (M0P28_07820) | 1531719..1532507 | - | 789 | WP_001235246.1 | type II toxin-antitoxin system toxin PezT | Toxin |
M0P28_RS07825 (M0P28_07825) | 1532507..1532983 | - | 477 | WP_000578720.1 | type II toxin-antitoxin system antitoxin PezA | Antitoxin |
M0P28_RS07830 (M0P28_07830) | 1533053..1533343 | - | 291 | WP_000667953.1 | hypothetical protein | - |
M0P28_RS07835 (M0P28_07835) | 1533393..1533782 | - | 390 | WP_000048066.1 | DUF5945 family protein | - |
M0P28_RS07840 (M0P28_07840) | 1533779..1534006 | - | 228 | WP_000110922.1 | DUF5965 family protein | - |
M0P28_RS07845 (M0P28_07845) | 1534034..1535134 | - | 1101 | WP_000196860.1 | toprim domain-containing protein | - |
M0P28_RS07850 (M0P28_07850) | 1535174..1535812 | - | 639 | WP_014636296.1 | hypothetical protein | - |
M0P28_RS07855 (M0P28_07855) | 1535907..1536197 | - | 291 | WP_000893083.1 | DUF5966 family protein | - |
M0P28_RS07860 (M0P28_07860) | 1536211..1536510 | - | 300 | WP_017767994.1 | DUF5962 family protein | - |
M0P28_RS07865 (M0P28_07865) | 1536581..1537540 | - | 960 | Protein_1488 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | tet(O) | - | 1479743..1580454 | 100711 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 263 a.a. Molecular weight: 29881.95 Da Isoelectric Point: 6.5023
>T269525 WP_001235246.1 NZ_CP116958:c1532507-1531719 [Streptococcus pasteurianus]
MRLEEFSEVEFQKALQRTIRALTRGKTIPDQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEHLVDELSKRGYHLLIEGTLRTTQVPRQTAQLLTSKGYQVSLAIIGTKPELSYLSTLIRYEE
LYAIDPTQARATPKDHHDGIVENLVDNLRELEREQLFDQIQIYQRDRACIYDSETDEGSAAEVLQDCLFGKCSKVEEEMM
KLGRERLVKLNNKNLLESNYGI
MRLEEFSEVEFQKALQRTIRALTRGKTIPDQPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSQHPNYLALQE
KYGKDSVDYTKGFAGKMVEHLVDELSKRGYHLLIEGTLRTTQVPRQTAQLLTSKGYQVSLAIIGTKPELSYLSTLIRYEE
LYAIDPTQARATPKDHHDGIVENLVDNLRELEREQLFDQIQIYQRDRACIYDSETDEGSAAEVLQDCLFGKCSKVEEEMM
KLGRERLVKLNNKNLLESNYGI
Download Length: 789 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18199.65 Da Isoelectric Point: 4.4582
>AT269525 WP_000578720.1 NZ_CP116958:c1532983-1532507 [Streptococcus pasteurianus]
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYVDIVGEDKMLTPVEDYQLTLKIE
VIKERGAAILSQLYRYQDSQGIACDDETNPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVVA
MIGDNIKSLRRTHDLTQPEFAKMVGISRNSLSRYENGTSTVSTELIDRICQKFNVSYVDIVGEDKMLTPVEDYQLTLKIE
VIKERGAAILSQLYRYQDSQGIACDDETNPWILMSDDLAELINTKIYLVDTFDEIERYNGYLDGIERMLDMVHHRVVA
Download Length: 477 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|