Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/- |
| Location | 1277131..1278224 | Replicon | chromosome |
| Accession | NZ_CP116958 | ||
| Organism | Streptococcus pasteurianus strain WUSP074 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | M0P28_RS06575 | Protein ID | WP_000233000.1 |
| Coordinates | 1277131..1278000 (-) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | M0P28_RS06580 | Protein ID | WP_044720927.1 |
| Coordinates | 1278015..1278224 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0P28_RS06545 (M0P28_06545) | 1272255..1272926 | - | 672 | WP_044720945.1 | Rep family protein | - |
| M0P28_RS06550 (M0P28_06550) | 1273498..1273905 | - | 408 | WP_235809127.1 | hypothetical protein | - |
| M0P28_RS06555 (M0P28_06555) | 1274334..1275071 | - | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M0P28_RS06560 (M0P28_06560) | 1275196..1275279 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| M0P28_RS06565 (M0P28_06565) | 1275520..1276383 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| M0P28_RS06570 (M0P28_06570) | 1276416..1277150 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| M0P28_RS06575 (M0P28_06575) | 1277131..1278000 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| M0P28_RS06580 (M0P28_06580) | 1278015..1278224 | - | 210 | WP_044720927.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M0P28_RS06585 (M0P28_06585) | 1278546..1279349 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
| M0P28_RS06590 (M0P28_06590) | 1279403..1280887 | - | 1485 | WP_044720925.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
| M0P28_RS06595 (M0P28_06595) | 1281379..1282941 | - | 1563 | WP_117479901.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | tet(L) / tet(O/W/32/O) / erm(B) / ant(6)-Ia / lnu(B) / lsa(E) | - | 1258701..1280887 | 22186 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T269524 WP_000233000.1 NZ_CP116958:c1278000-1277131 [Streptococcus pasteurianus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|