Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1494742..1495228 | Replicon | chromosome |
| Accession | NZ_CP116957 | ||
| Organism | Streptococcus pasteurianus strain WUSP070 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F5X5E2 |
| Locus tag | M0P24_RS07460 | Protein ID | WP_013851589.1 |
| Coordinates | 1494742..1495011 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | F5X5E1 |
| Locus tag | M0P24_RS07465 | Protein ID | WP_013851588.1 |
| Coordinates | 1495001..1495228 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0P24_RS07440 (M0P24_07440) | 1492177..1492731 | - | 555 | WP_013851590.1 | hypothetical protein | - |
| M0P24_RS07445 (M0P24_07445) | 1492928..1493449 | - | 522 | WP_003063789.1 | transcription repressor NadR | - |
| M0P24_RS07450 (M0P24_07450) | 1493861..1494073 | + | 213 | WP_231844751.1 | DUF3267 domain-containing protein | - |
| M0P24_RS07455 (M0P24_07455) | 1494101..1494265 | + | 165 | WP_231844750.1 | hypothetical protein | - |
| M0P24_RS07460 (M0P24_07460) | 1494742..1495011 | - | 270 | WP_013851589.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M0P24_RS07465 (M0P24_07465) | 1495001..1495228 | - | 228 | WP_013851588.1 | DUF6290 family protein | Antitoxin |
| M0P24_RS07470 (M0P24_07470) | 1495861..1496073 | - | 213 | WP_069789057.1 | hypothetical protein | - |
| M0P24_RS07475 (M0P24_07475) | 1496133..1496594 | - | 462 | WP_069789056.1 | hypothetical protein | - |
| M0P24_RS07480 (M0P24_07480) | 1496920..1497351 | - | 432 | WP_061100156.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M0P24_RS07485 (M0P24_07485) | 1497372..1497962 | - | 591 | WP_248497809.1 | hypothetical protein | - |
| M0P24_RS07490 (M0P24_07490) | 1498209..1498511 | - | 303 | WP_069789038.1 | hypothetical protein | - |
| M0P24_RS07495 (M0P24_07495) | 1498671..1499516 | - | 846 | WP_248497811.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1484040..1583716 | 99676 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10500.51 Da Isoelectric Point: 10.4700
>T269522 WP_013851589.1 NZ_CP116957:c1495011-1494742 [Streptococcus pasteurianus]
MTYRLVVSDKVKKQLKKMDKHVRLMLAKDMKKHLDGVENPRQMGKALTGQFKGLWRYRIGNYRVICDIIDDDLVILAIEV
GHRKDIYKN
MTYRLVVSDKVKKQLKKMDKHVRLMLAKDMKKHLDGVENPRQMGKALTGQFKGLWRYRIGNYRVICDIIDDDLVILAIEV
GHRKDIYKN
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A135YV33 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A135YV28 |