Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Xre-MNT/- |
| Location | 856221..857314 | Replicon | chromosome |
| Accession | NZ_CP116957 | ||
| Organism | Streptococcus pasteurianus strain WUSP070 | ||
Toxin (Protein)
| Gene name | MNTss | Uniprot ID | R3JIN1 |
| Locus tag | M0P24_RS04310 | Protein ID | WP_000233000.1 |
| Coordinates | 856445..857314 (+) | Length | 290 a.a. |
Antitoxin (Protein)
| Gene name | Xress | Uniprot ID | - |
| Locus tag | M0P24_RS04305 | Protein ID | WP_044720927.1 |
| Coordinates | 856221..856430 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0P24_RS04290 (M0P24_04290) | 851918..853066 | + | 1149 | Protein_852 | recombinase family protein | - |
| M0P24_RS04295 (M0P24_04295) | 853558..855042 | + | 1485 | WP_044720925.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
| M0P24_RS04300 (M0P24_04300) | 855096..855899 | + | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
| M0P24_RS04305 (M0P24_04305) | 856221..856430 | + | 210 | WP_044720927.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M0P24_RS04310 (M0P24_04310) | 856445..857314 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
| M0P24_RS04315 (M0P24_04315) | 857295..858029 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
| M0P24_RS04320 (M0P24_04320) | 858062..858925 | + | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
| M0P24_RS04325 (M0P24_04325) | 859166..859249 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| M0P24_RS04330 (M0P24_04330) | 859374..860111 | + | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M0P24_RS04335 (M0P24_04335) | 860540..860947 | + | 408 | WP_235809127.1 | hypothetical protein | - |
| M0P24_RS04340 (M0P24_04340) | 861539..862210 | + | 672 | WP_044720945.1 | Rep family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | aac(6')-aph(2'') / lsa(E) / lnu(B) / ant(6)-Ia / erm(B) / tet(O/W/32/O) / tet(L) | - | 809861..881533 | 71672 | |
| - | inside | IScluster/Tn | aac(6')-aph(2'') / lsa(E) / lnu(B) / ant(6)-Ia / erm(B) / tet(O/W/32/O) / tet(L) | - | 845234..868250 | 23016 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T269521 WP_000233000.1 NZ_CP116957:856445-857314 [Streptococcus pasteurianus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|