Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 19454..20010 | Replicon | plasmid p2939_90_3 |
Accession | NZ_CP116946 | ||
Organism | Providencia alcalifaciens strain 2939/90 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PO864_RS20535 | Protein ID | WP_282490785.1 |
Coordinates | 19454..19729 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PO864_RS20540 | Protein ID | WP_282490786.1 |
Coordinates | 19720..20010 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO864_RS20525 (PO864_20760) | 14749..17640 | - | 2892 | WP_282490782.1 | conjugal transfer mating-pair stabilization protein TraG | - |
PO864_RS20530 (PO864_20765) | 17653..19029 | - | 1377 | WP_282490783.1 | conjugal transfer pilus assembly protein TraH | - |
PO864_RS20535 (PO864_20770) | 19454..19729 | - | 276 | WP_282490785.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PO864_RS20540 (PO864_20775) | 19720..20010 | - | 291 | WP_282490786.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PO864_RS20545 (PO864_20780) | 20069..20599 | - | 531 | WP_282490788.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
PO864_RS20550 (PO864_20785) | 20605..20895 | - | 291 | WP_282490789.1 | hypothetical protein | - |
PO864_RS20555 (PO864_20790) | 20916..21671 | - | 756 | WP_282490794.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
PO864_RS20560 | 21857..22846 | - | 990 | Protein_17 | conjugal transfer protein TraN | - |
PO864_RS20565 (PO864_20800) | 23512..24147 | - | 636 | WP_282490790.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..58284 | 58284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10020.76 Da Isoelectric Point: 9.4165
>T269520 WP_282490785.1 NZ_CP116946:c19729-19454 [Providencia alcalifaciens]
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFIARDLADMGISGRRFALNIDVTPA
TAGNSNCCCIR
MELKWTSKALSDLSRVYDFLALSNSVAAARVVQTLTKAPMLLLIKNPRMGEQLFQFIARDLADMGISGRRFALNIDVTPA
TAGNSNCCCIR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|